PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000607330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 501aa    MW: 54903.5 Da    PI: 5.4059
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000607330genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEde+l+++++  G g+W++ ++  g+ R++k+c++rw +yl
    MDP0000607330 14 KGRWTAEEDEILLNYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding48.32.3e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E+++++++++ lG++ W++Ia+ ++ gRt++++k++w+++l
    MDP0000607330  67 RGNISSQEEDIIIKLHASLGNR-WSLIASQLP-GRTDNEIKNYWNSHL 112
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.625961IPR017930Myb domain
SuperFamilySSF466891.3E-2711108IPR009057Homeodomain-like
SMARTSM007173.0E-121363IPR001005SANT/Myb domain
PfamPF002491.8E-141461IPR001005SANT/Myb domain
CDDcd001678.91E-101661No hitNo description
PROSITE profilePS5129424.50762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2465116IPR009057Homeodomain-like
SMARTSM007174.4E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1367112IPR001005SANT/Myb domain
CDDcd001672.21E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTAE EDEILLNYIQ ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SSQEEDIIIK LHASLGNRWS LIASQLPGRT DNEIKNYWNS HLSRKIGTFR  120
RPATTTVITT EISTSXPPAG DEVSAAMELG PPKRRGGRTS RWXMKKNKTY STTKPKGLKA  180
RLRQSHHKHD NIAAAAADDD RLNNAHEAIA LPTKSNNKNV DTMQDGYVLL MEVPDQQQET  240
RGGGIAMPAT VIDHQKETDG EKLILGPHPH GHDDDDMNEY VGINGGLLGF TDYLMDDINE  300
DEILDPNGVM ALSSSEINIH QDADHFPDAV ISDHQDTELP SSCDQLVICP NKVMTTTTTT  360
TASSDDHHDQ ELESSSCGCN LSSSSSISNS NGKVVTGDLH SCGSSLSLTN TSNCDTEDGH  420
TAGGFGNHDQ ILWDWESVLS NAGTGHDYLW DGHDRQNMLS WLREGESATA AGDDDHADAM  480
DFXXXXPPXX KSSGYQARKH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.144810.0bud
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744700.0DQ074470.1 Malus x domestica MYB22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008369060.10.0PREDICTED: uncharacterized protein LOC103432638
TrEMBLA0A0N7EZN10.0A0A0N7EZN1_PYRPY; MYB12
STRINGGLYMA02G01740.17e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.11e-71myb domain protein 12